The domain within your query sequence starts at position 28 and ends at position 151; the E-value for the ANAPC8 domain shown below is 6.9e-31.
DLQEIKKQLLLIAGLTRERGLLHSSKWSAELAFSLPALPLSELQPPPPLTEEDAQDVDAY TLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVK NEAL
ANAPC8 |
---|
PFAM accession number: | PF04049 |
---|---|
Interpro abstract (IPR007192): | The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8). This entry is for CDC23. |
GO process: | regulation of mitotic metaphase/anaphase transition (GO:0030071) |
GO component: | anaphase-promoting complex (GO:0005680) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANAPC8