The domain within your query sequence starts at position 76 and ends at position 441; the E-value for the ANF_receptor domain shown below is 3.7e-31.

EFLLVMFFAIDEINRNPYLLPNITLMFSFIGGNCQDLLRVMDQAYTQINGHMNFVNYFCY
LDDSCAIGLTGPSWKTSLKLAMHSSMPLVFFGPFNPNLRDHDRLPHVHQVAPKDTHLSHG
MVSLMFHFRWTWIGMVISDDDQGIQFLSDLREESQRHGICLAFVNMIPENMQIYMTRATI
YDQQIMTSSAKVVIIYGEMNSTLEVSFRRWEELGARRIWITTSQWDVITNKKDFTLNLFH
GTITFAHHRVEIPKLNKFMQTMNTAKYPVDISHTILEWNYFNCSISKNSIRMHHITFNNT
LEWTSLHNYDMAMSDEGYSLYNAVYAVAHTYHEYIFQQVESQKKAKPKRYFTACQQVSSL
MKTRVF

ANF_receptor

ANF_receptor
PFAM accession number:PF01094
Interpro abstract (IPR001828): This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [(PUBMED:8011339)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANF_receptor