The domain within your query sequence starts at position 99 and ends at position 299; the E-value for the ANF_receptor domain shown below is 5.1e-12.
VDTEAVAQLLDFVSSQTHVPILSISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLE EYDWSAFAVITSLHPGHALFLEGVRAVADASYLSWRLLDVLTLELGPGGPRARTQRLLRQ VDAPVLVAYCSREEAEVLFAEAAQAGLVGPGHVWLVPNLALGSTDAPPAAFPVGLISVVT ESWRLSLRQKVRDGVAILALG
ANF_receptor |
---|
PFAM accession number: | PF01094 |
---|---|
Interpro abstract (IPR001828): | This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [ (PUBMED:8011339) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANF_receptor