The domain within your query sequence starts at position 1 and ends at position 345; the E-value for the ANKH domain shown below is 1e-223.
MVKFPALTHYWPLIRFLVPLGITNIAIDFGEQALNRGIAAVKEDAVEMLASYGLAYSLMK FFTGPMSDFKNVGLVFVNSKRDRAKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHV DESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHKYSFLVGCASISDVIAQVVFVAILL HSHLECREPLLIPILSLYMGALVRCTTLCLGYYRNIHDIIPDRSGPELGGDATIRKMLSF WWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVY PAFDKNNPSNKLANTSNTVTSAHIKKFTFVCMALSLTLCFVMFWT
ANKH |
---|
PFAM accession number: | PF07260 |
---|---|
Interpro abstract (IPR009887): | This family consists of several progressive ankylosis protein (ANK or ANKH) sequences. The ANK protein spans the outer cell membrane and shuttles inorganic pyrophosphate (PP i ), a major inhibitor of physiologic and pathologic calcification, bone mineralisation and bone resorption [ (PUBMED:11326272) ]. Mutations in ANK are thought to give rise to Craniometaphyseal dysplasia (CMD) which is a rare skeletal disorder characterised by progressive thickening and increased mineral density of craniofacial bones and abnormally developed metaphyses in long bones [ (PUBMED:11326338) ]. |
GO process: | phosphate ion transmembrane transport (GO:0035435) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | phosphate ion transmembrane transporter activity (GO:0015114) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANKH