The domain within your query sequence starts at position 1 and ends at position 345; the E-value for the ANKH domain shown below is 1e-223.

MVKFPALTHYWPLIRFLVPLGITNIAIDFGEQALNRGIAAVKEDAVEMLASYGLAYSLMK
FFTGPMSDFKNVGLVFVNSKRDRAKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHV
DESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHKYSFLVGCASISDVIAQVVFVAILL
HSHLECREPLLIPILSLYMGALVRCTTLCLGYYRNIHDIIPDRSGPELGGDATIRKMLSF
WWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVY
PAFDKNNPSNKLANTSNTVTSAHIKKFTFVCMALSLTLCFVMFWT

ANKH

ANKH
PFAM accession number:PF07260
Interpro abstract (IPR009887):

This family consists of several progressive ankylosis protein (ANK or ANKH) sequences. The ANK protein spans the outer cell membrane and shuttles inorganic pyrophosphate (PPi), a major inhibitor of physiologic and pathologic calcification, bone mineralisation and bone resorption [(PUBMED:11326272)]. Mutations in ANK are thought to give rise to Craniometaphyseal dysplasia (CMD) which is a rare skeletal disorder characterised by progressive thickening and increased mineral density of craniofacial bones and abnormally developed metaphyses in long bones [(PUBMED:11326338)].

GO process:phosphate ion transmembrane transport (GO:0035435)
GO component:integral component of membrane (GO:0016021)
GO function:phosphate ion transmembrane transporter activity (GO:0015114)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANKH