The domain within your query sequence starts at position 24 and ends at position 298; the E-value for the AP1AR domain shown below is 3.5e-152.

GGGSKYFRTCPRGEHLTIEFENLVESDEGESPGSSHRPLTEDEIADLQERHYDSIAEKQK
DVDRKIQRQLALQEEKLRLEEEALYAAQREAARAARQRKLLEQEKQRVAQHYHCSSGDYQ
SAGPEDDFESSLRNIKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSL
DLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSSKKGSNPTSASDDSNGLEWENDFVSA
EMDDNGNSEYSGFVNPVLELSDSAIKQSDTDQQIR

AP1AR

AP1AR
PFAM accession number:PF15745
Interpro abstract (IPR031483):

AP-1 complex-associated regulatory protein (AP1AR), also known as gadkin or gamma-BAR, is a negative regulator of the actin-related protein (ARP)2/3 complex, a major regulator of actin dynamics. Through inhibition of ARP2/3, gadkin negatively regulates cell spreading and motility [ (PUBMED:22689987) ]. Gadkin is also a modulator of adaptor protein (AP)-1-mediated endosomal membrane trafficking [ (PUBMED:15775984) (PUBMED:19965873) (PUBMED:21525240) ].

GO process:vesicle targeting, trans-Golgi to endosome (GO:0048203), negative regulation of substrate adhesion-dependent cell spreading (GO:1900025), regulation of Arp2/3 complex-mediated actin nucleation (GO:0034315), negative regulation of cell motility (GO:2000146)
GO function:AP-1 adaptor complex binding (GO:0035650)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AP1AR