The domain within your query sequence starts at position 30 and ends at position 81; the E-value for the APC_N_CC domain shown below is 2.7e-34.
ASYEQLVRQVEALKAENTHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKL
APC_N_CC |
![]() |
---|
PFAM accession number: | PF16689 |
---|---|
Interpro abstract (IPR032038): | This entry represents the N-terminal, coiled-coil dimerisation domain of the adenomatosis polyposis coli (APC) tumour-repressor proteins. It plays a key role in the regulation of cellular levels of the oncogene product beta-catenin. Coiled-coil regions are binding repeats that in this case bind to the armadillo repeat region of beta-catenin [ (PUBMED:10926498) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry APC_N_CC