The domain within your query sequence starts at position 4 and ends at position 55; the E-value for the APC_N_CC domain shown below is 6e-32.

ASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSI

APC_N_CC

APC_N_CC
PFAM accession number:PF16689
Interpro abstract (IPR032038):

This entry represents the N-terminal, coiled-coil dimerisation domain of the adenomatosis polyposis coli (APC) tumour-repressor proteins. It plays a key role in the regulation of cellular levels of the oncogene product beta-catenin. Coiled-coil regions are binding repeats that in this case bind to the armadillo repeat region of beta-catenin [(PUBMED:10926498)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry APC_N_CC