The domain within your query sequence starts at position 2223 and ends at position 2579; the E-value for the APC_basic domain shown below is 1.5e-110.

SISRGRTMIHIPGLRNSSSSTSPVSKKGPPLKTPASKSPSEGPGATTSPRGTKPAGKSEL
SPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISPPNKL
SQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLTKQASLSKNASSIPRSESASKGLN
QMSNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESASF
ESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYNDGRP
TKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSE

APC_basic

APC_basic
PFAM accession number:PF05956
Interpro abstract (IPR009234):

This region of the APC family of proteins is known as the basic domain. It contains a high proportion of positively charged amino acids and interacts with microtubules [(PUBMED:9654054)].

GO process:Wnt signaling pathway (GO:0016055)
GO function:microtubule binding (GO:0008017)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry APC_basic