The domain within your query sequence starts at position 6 and ends at position 125; the E-value for the APG6 domain shown below is 1.5e-57.

LLTTAQAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNA
TFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVP

APG6

APG6
PFAM accession number:PF04111
Interpro abstract (IPR007243):

In yeasts, vacuolar protein sorting-associated protein 30 (Vps30), also known as autophagy-related protein 6 (Atg6), is a common component of two distinct phosphatidylinositol 3-kinase complexes. In complex I, Atg14 links Vps30 to Vps34 lipid kinase and plays a specific role in autophagy, while in complex II, Vps38 links Vps30 to Vps34 and plays an important role in vacuolar protein sorting [(PUBMED:22437838)]. The C-terminal of Vps30 contains a globular fold comprised of three beta-sheet-alpha-helix repeats and is required for autophagy through the targeting of complex I to the pre-autophagosomal structure. The N-terminal of Vps30 is required for vacuolar protein sorting [(PUBMED:22437838)].

Beclin 1, the mammalian homologue of yeast Atg6/Vps30, is a tumour suppressor that coordinately regulates the autophagy and membrane trafficking involved in several physiological and pathological processes [(PUBMED:21311563), (PUBMED:22170155)].

GO process:autophagy (GO:0006914)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry APG6