The domain within your query sequence starts at position 24 and ends at position 221; the E-value for the AP_endonuc_2 domain shown below is 4.2e-28.
LHAAGRAGFEAAEVAWPYTESPQALASAAQTAGLRLVLINTPRGDHEKGEMGLGEGLEQA VLYAKALGCPRIHLMAGRVPQGADRAAVKGEMETVFVENLKHAAGVLAQENLVGLLEPIN TRITDPQYFLDTPRQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPTVGHVQV AQVPDRGEPGSSGELDFT
AP_endonuc_2 |
---|
PFAM accession number: | PF01261 |
---|---|
Interpro abstract (IPR013022): | This entry represents a structural motif with a beta/alpha TIM barrel found in several proteins families:
These proteins share similar, but not identical, metal-binding sites. In addition, xylose isomerase and L-rhamnose isomerase each have additional alpha-helical domains involved in tetramer formation. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AP_endonuc_2