The domain within your query sequence starts at position 199 and ends at position 334; the E-value for the ARA70 domain shown below is 4.7e-51.

VSLSEWLLVSKPAIGLQAPYVPSTNPQDWLIPKQTSENSQTSARACSFFSDAWGNLKGLE
NWLLNSHQQEIAGKPSSSKCNSHCSTSSFSPEAEKAEDVELLDQDELDLSDWLVTPQEPC
ELEKPVDGSWETSEKF

ARA70

ARA70
PFAM accession number:PF12489
Interpro abstract (IPR022174):

This domain family is found in eukaryotes, and is typically between 127 and 138 amino acids in length. This family is ARA70, a nuclear coactivator which interacts with peroxisome proliferator-activated receptor gamma (PPARgamma) to regulate transcription and the addition of the PPARgamma ligand (prostaglandin J2) enhances this interaction.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ARA70