The domain within your query sequence starts at position 143 and ends at position 249; the E-value for the ARF7EP_C domain shown below is 4.9e-40.

RTAKALRSLQFTNPGKQTEFAPEGGKREKRKLTKATSAASDRQIIPAKSKVYDSQGLLIF
SGMDLCDCLDEDCLGCFYACPTCGSTKCGAECRCDRKWLYEQIEIEG

ARF7EP_C

ARF7EP_C
PFAM accession number:PF14949
Interpro abstract (IPR029264):

This domain represents the C terminus of the ARF7 effector protein (ARF7EP), also known as ARL14 effector protein. ARF7EP interacts with actin based motor protein myosin 1E (MYO1E) and may be involved in connecting MHC class II-containing cytoplasmic vesicles to the actin network in dendritic cells [ (PUBMED:21458045) ]. It contains a conserved CXCXXXXCXXCXXXCXXCXXXXCXXXCXC motif in its C-terminal half.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ARF7EP_C