SMART: Pfam domain ARS2

The domain within your query sequence starts at position 635 and ends at position 845; the E-value for the ARS2 domain shown below is 5.5e-113.

MPNRCGIIHVRGPMPPNRISHGEVLEWQKTFEEKLTPLLSVRESLSEEEAQKMGRKDPEQ
EVEKFVTSNTQELGKDKWLCPLSGKKFKGPEFVRKHIFNKHAEKIEEVKKEVAFFNNFLT
DAKRPALPEIKPAQPPGPAQSLTPGLPYPHQTPQGLMPYGQPRPPILGYGVPTGGPPYPH
APYGAGRGNYDAFRGQGGYPGKPRNRMVRGD

ARS2

PFAM accession number:	PF04959
Interpro abstract (IPR007042):	This domain can be found in the C terminus of the SERRATE (SE) from plants and its homologue, Ars2, from animals. They play a role in nuclear RNA metabolism. They interact with the nuclear cap-binding complex (CBC) and mediates interactions with diverse RNA processing and transport machineries in a transcript-dependent manner. Interestingly, the plant SERRATE does not have the RNA recognition motif (RRM) domain found in metazoans and S. pombe [ (PUBMED:29703953) ].

PFAM accession number:

PF04959

Interpro abstract (IPR007042):

This domain can be found in the C terminus of the SERRATE (SE) from plants and its homologue, Ars2, from animals. They play a role in nuclear RNA metabolism. They interact with the nuclear cap-binding complex (CBC) and mediates interactions with diverse RNA processing and transport machineries in a transcript-dependent manner. Interestingly, the plant SERRATE does not have the RNA recognition motif (RRM) domain found in metazoans and S. pombe [ (PUBMED:29703953) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ARS2