The domain within your query sequence starts at position 29 and ends at position 146; the E-value for the ART domain shown below is 2.1e-36.
LSLVPDTFDDAYVGCSEEMEEKAGLLLKEEMARHALLRESWEAAQEAWAHRRHKLTLPPG FKAQHGVAIMVYTNSSNTLYWELNQAVRTGGEKRRGCVSSRAVGQPEAPSTEALALQS
ART |
---|
PFAM accession number: | PF01129 |
---|---|
Interpro abstract (IPR000768): | Mono-ADP-ribosylation is a post-translational modification of proteins in which the ADP-ribose moiety of NAD is transferred to proteins. This process is responsible for the toxicity of some bacterial toxins (e.g., cholera and pertussis toxins). Mono (ADP-ribosyl) transferases exist in vertebrates EC 2.4.2.31 that transfer ADP-ribose to arginine [ (PUBMED:8703012) ]. |
GO process: | protein ADP-ribosylation (GO:0006471) |
GO function: | NAD(P)+-protein-arginine ADP-ribosyltransferase activity (GO:0003956) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ART