The domain within your query sequence starts at position 367 and ends at position 436; the E-value for the ASL_C2 domain shown below is 1.6e-26.

DMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSH
VWDYSHSVEQ

ASL_C2

ASL_C2
PFAM accession number:PF14698
Interpro abstract (IPR029419):

This domain is found at the C terminus of argininosuccinate lyase [(PUBMED:11698398), (PUBMED:9256435)].

Argininosuccinate lyase (ASL, EC 4.3.2.1) participates in arginine synthesis in all organisms catalysing the reversible breakdown of argininosuccinate to arginine and fumarate. The reaction is also part of the urea cycle [(PUBMED:15502303)]. The crystal structures of ASLs from several species have been studied, in particular the duck delta1 and delta2 eye lens crystallins, which are inactive and active homologues of ASL, respectively [(PUBMED:11698398)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ASL_C2