The domain within your query sequence starts at position 368 and ends at position 435; the E-value for the ASL_C2 domain shown below is 1.1e-22.
MLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHV WDYSHSVE
ASL_C2 |
---|
PFAM accession number: | PF14698 |
---|---|
Interpro abstract (IPR029419): | This domain is found at the C terminus of argininosuccinate lyase [ (PUBMED:11698398) (PUBMED:9256435) ]. Argininosuccinate lyase (ASL, EC 4.3.2.1 ) participates in arginine synthesis in all organisms catalysing the reversible breakdown of argininosuccinate to arginine and fumarate. The reaction is also part of the urea cycle [ (PUBMED:15502303) ]. The crystal structures of ASLs from several species have been studied, in particular the duck delta1 and delta2 eye lens crystallins, which are inactive and active homologues of ASL, respectively [ (PUBMED:11698398) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ASL_C2