The domain within your query sequence starts at position 236 and ends at position 361; the E-value for the ASXH domain shown below is 5.9e-40.

KPATGQMKRNRGEEVDFETPGSILVNTNLRALINSRTFHALPLHFQQQLLLLLPEVDRQV
GTDGLLRLSGSALNNEFFTHAAQSWRERLADGEFTHEMQVRLRQEMEKEKKVEQWKEKFF
EDYYGQ

ASXH

ASXH
PFAM accession number:PF13919
Interpro abstract (IPR028020):

This entry represents a conserved alpha helical domain with a characteristic LXXLL motif found in Asx and homologues [ (PUBMED:19270745) (PUBMED:19833123) ]. The LXXLL motif is detected in diverse transcription factors, coactivators and co-repressors and is implicated in mediating interactions between them [ (PUBMED:15691650) ]. The Asx homology (ASXH) domain is found in animals, fungi and plants [ (PUBMED:22186017) ] and is predicted to play a role in mediating contact between transcription factors and chromatin-associated complexes. In Drosophila Asx and Human ASXL1, the ASXH domain is predicted to mediate interactions with the Calypso and BAP1 deubiquitinases (DUBs) which further belong to the UCHL5/UCH37 clade of DUBs [ (PUBMED:22186017) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ASXH