The domain within your query sequence starts at position 59 and ends at position 270; the E-value for the ATF7IP_BD domain shown below is 4.7e-75.

KENVKVMKVSEQINENACGALERHTALLEQVKHWIRQEICMINCNLFDKKLNELNERIGK
TQCKSRHEAIAGELFVKIRRLQKRIKTVLSSQRNCLEPNTLPSNTVCKVTDSEAMNLNVT
QKSVKSRSKRISSVNHTPLNSSEKAGRKTNLPSTCVEFASESNTDDVMLISVKNSNLTTS
ITSEQTEIRKNTSRNLSNSPNSMIKVGPVEKK

ATF7IP_BD

ATF7IP_BD
PFAM accession number:PF16788
Interpro abstract (IPR031870):

This entry represents a short conserved region of activating transcription factor 7-interacting protein 1 found in higher eukaryotes. This domain appears to bind several key proteins such as TFIIE-alpha and TFIIE-beta as well the transcriptional regulator Sp1 which are part of the transcriptional machinery [(PUBMED:19106100)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATF7IP_BD