The domain within your query sequence starts at position 9 and ends at position 319; the E-value for the ATG7_N domain shown below is 1.5e-106.

PTSTVVRPTPHCFPAMRLSSSGCEHLTVRLVRTVAMGDPGLAKLQFAPFNSALDVGFWHE
LTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPTRLTLEFSAFDMSASTPAHCCPAMGTLHN
TNTLEAFKTADKKLLLEQSANEIWEAIKSGAALENPMLLNKFLLLTFADLKKYHFYYWFC
CPALCLPESIPLIRGPVSLDQRLSPKQIQALEHAYDDLCRAEGVTALPYFLFKYDDDTVL
VSLLKHYSDFFQGQRTKITVGVYDPCNLAQYPGWPLRNFLVLAAHRWSGSFQSVEVLCFR
DRTMQGARDVT

ATG7_N

ATG7_N
PFAM accession number:PF16420
Interpro abstract (IPR032197):

This is the N-terminal domain of ubiquitin-like modifier-activating enzyme ATG7. In Arabidopsis this domain binds the E2 enzymes ATG10 and ATG3 [(PUBMED:23142983)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATG7_N