The domain within your query sequence starts at position 1976 and ends at position 2071; the E-value for the ATG_C domain shown below is 1.4e-33.

HHRLAHQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPA
VVRPLIVATEATSNVLGGMRNQIRPDVRQDESQKWR

ATG_C

ATG_C
PFAM accession number:PF09333
Interpro abstract (IPR015412):

Eukaryotes have developed an evolutionarily conserved process, termed autophagy, to survive starvation conditions. The vacuole or lysosome mediates the turnover and recycling of non-essential intracellular material for re-use in critical biosynthetic reactions. ATG2 (also known as Apg2) is required for the formation and/or completion of cytosolic sequestering vesicles that are needed for vacuolar import through both the Cvt pathway and autophagy, as well as for the specific degradation of peroxisomes. Apg2 is a peripheral membrane protein that localises to the previously identified perivacuolar compartment that contains Apg9 [(PUBMED:11382760)].

This entry represents the C-terminal domain of Apg2 and related proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATG_C