SMART: Pfam domain ATP-gua

The domain within your query sequence starts at position 154 and ends at position 401; the E-value for the ATP-gua_Ptrans domain shown below is 2e-105.

YFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEM
TEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVIS
MEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKL
PLLSKDNRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNY
LIDCERRL

ATP-gua_Ptrans

PFAM accession number:	PF00217
Interpro abstract (IPR022414):	ATP:guanido phosphotransferases are a family of structurally and functionally related enzymes [ (PUBMED:2324092) (PUBMED:7819288) ] that reversibly catalyse the transfer of phosphate between ATP and various phosphogens. The enzymes belonging to this family include: Glycocyamine kinase ( EC 2.7.3.1 ), which catalyses the transfer of phosphate from ATP to guanidoacetate. Arginine kinase ( EC 2.7.3.3 ), which catalyses the transfer of phosphate from ATP to arginine. Taurocyamine kinase ( EC 2.7.3.4 ), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to taurocyamine. Lombricine kinase ( EC 2.7.3.5 ), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to lombricine. Smc74, a cercaria-specific enzyme from Schistosoma mansoni [ (PUBMED:2324092) ]. Creatine kinase ( EC 2.7.3.2 ) (CK) [ (PUBMED:3896131) (PUBMED:2324105) ], which catalyses the reversible transfer of high energy phosphate from ATP to creatine, generating phosphocreatine and ADP. Creatine kinase plays an important role in energy metabolism of vertebrates. There are at least four different, but very closely related, forms of CK. Two isozymes, M (muscle) and B (brain), are cytosolic, while the other two are mitochondrial. In sea urchins there is a flagellar isozyme, which consists of the triplication of a CK-domain. A cysteine residue is implicated in the catalytic activity of these enzymes and the region around this active site residue is highly conserved. This entry represents the C-terminal catalytic domain of ATP:guanido phosphotransferase, which is comprised of a duplication where the common core consists of two beta-alpha-beta2-alpha repeats [ (PUBMED:8692275) ]. The substrate binding site is located in the cleft between N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain [ (PUBMED:8692275) ]. Eukaryotic phosphagen kinases consist of a small, ~100-residue, alpha-helical N-terminal domain and a larger, 250+- residue, C-terminal alpha/beta saddle domain in which many key residues involved in catalysis are found. The N-terminal domain undergoes significant conformational movements during catalysis, closing down on the catalytic pocket. It is involved in dimer formation. Bacterial phosphagen kinases have the large C-terminal domain seen in eukaryotic phosphagen kinases but lack the N-terminal domain [ (PUBMED:17932618) (PUBMED:18064398) (PUBMED:18499493) (PUBMED:20121101) ].
GO function:	kinase activity (GO:0016301), transferase activity, transferring phosphorus-containing groups (GO:0016772)

PFAM accession number:

PF00217

Interpro abstract (IPR022414):

ATP:guanido phosphotransferases are a family of structurally and functionally related enzymes [ (PUBMED:2324092) (PUBMED:7819288) ] that reversibly catalyse the transfer of phosphate between ATP and various phosphogens. The enzymes belonging to this family include:

Glycocyamine kinase ( EC 2.7.3.1 ), which catalyses the transfer of phosphate from ATP to guanidoacetate.
Arginine kinase ( EC 2.7.3.3 ), which catalyses the transfer of phosphate from ATP to arginine.
Taurocyamine kinase ( EC 2.7.3.4 ), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to taurocyamine.
Lombricine kinase ( EC 2.7.3.5 ), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to lombricine.
Smc74, a cercaria-specific enzyme from Schistosoma mansoni [ (PUBMED:2324092) ].
Creatine kinase ( EC 2.7.3.2 ) (CK) [ (PUBMED:3896131) (PUBMED:2324105) ], which catalyses the reversible transfer of high energy phosphate from ATP to creatine, generating phosphocreatine and ADP.

Creatine kinase plays an important role in energy metabolism of vertebrates. There are at least four different, but very closely related, forms of CK. Two isozymes, M (muscle) and B (brain), are cytosolic, while the other two are mitochondrial. In sea urchins there is a flagellar isozyme, which consists of the triplication of a CK-domain. A cysteine residue is implicated in the catalytic activity of these enzymes and the region around this active site residue is highly conserved.

This entry represents the C-terminal catalytic domain of ATP:guanido phosphotransferase, which is comprised of a duplication where the common core consists of two beta-alpha-beta2-alpha repeats [ (PUBMED:8692275) ]. The substrate binding site is located in the cleft between N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain [ (PUBMED:8692275) ].

Eukaryotic phosphagen kinases consist of a small, ~100-residue, alpha-helical N-terminal domain and a larger, 250+- residue, C-terminal alpha/beta saddle domain in which many key residues involved in catalysis are found. The N-terminal domain undergoes significant conformational movements during catalysis, closing down on the catalytic pocket. It is involved in dimer formation. Bacterial phosphagen kinases have the large C-terminal domain seen in eukaryotic phosphagen kinases but lack the N-terminal domain [ (PUBMED:17932618) (PUBMED:18064398) (PUBMED:18499493) (PUBMED:20121101) ].

GO function:

kinase activity (GO:0016301), transferase activity, transferring phosphorus-containing groups (GO:0016772)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-gua_Ptrans