The domain within your query sequence starts at position 394 and ends at position 617; the E-value for the ATP-sulfurylase domain shown below is 7.8e-74.

DQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHP
LGGWTKDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVA
GANFYIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMD
YYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEY

ATP-sulfurylase

ATP-sulfurylase
PFAM accession number:PF01747
Interpro abstract (IPR024951): This domain is the catalytic domain of ATP-sulfurylase or sulphate adenylyltransferase (EC 2.7.7.4). ATP-sulfurylase catalyses the synthesis of adenosine-phosphosulphate (APS) from ATP and inorganic sulphate [(PUBMED:9671738)]. Sometimes is found as part of a bifunctional polypeptide chain associated with adenylylsulphate kinase (IPR002891). Both enzymes are required for PAPS (phosphoadenosine-phosphosulphate) synthesis from inorganic sulphate [(PUBMED:8522184)].
GO function:sulfate adenylyltransferase (ATP) activity (GO:0004781)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-sulfurylase