The domain within your query sequence starts at position 1 and ends at position 60; the E-value for the ATP11 domain shown below is 4.6e-20.

GIVLMTAEMDSTFLNVVEAQCIANQVQLFYATDRKEIYGLVETFNFRPNEFKYMSVIAEL

ATP11

ATP11
PFAM accession number:PF06644
Interpro abstract (IPR010591):

This family consists of several eukaryotic ATP11 proteins. The expression of functional F1-ATPase requires two proteins which are encoded by the ATP11 and ATP12 genes [ (PUBMED:1532796) ]. Atp11p is a molecular chaperone of the mitochondrial matrix that participates in the biogenesis pathway to form F1, which is the catalytic unit of ATP synthase. It binds to the free beta subunits of F1, which prevents the beta subunit from associating with itself in non-productive complex. It also allows for the formation of a (alpha beta)3 hexamer [ (PUBMED:12829692) ].

GO process:protein-containing complex assembly (GO:0065003)
GO component:mitochondrion (GO:0005739)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP11