The domain within your query sequence starts at position 25 and ends at position 71; the E-value for the ATP1G1_PLM_MAT8 domain shown below is 5.5e-30.

NKNDPFYYDWYSLRVGGLICAGILCALGIIVLMSGKCKCKFRQKPSH

ATP1G1_PLM_MAT8

ATP1G1_PLM_MAT8
PFAM accession number:PF02038
Interpro abstract (IPR000272):

The FXYD protein family contains at least seven members in mammals [(PUBMED:12538882)]. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.

Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.

GO process:ion transport (GO:0006811)
GO component:membrane (GO:0016020)
GO function:ion channel activity (GO:0005216)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP1G1_PLM_MAT8