The domain within your query sequence starts at position 1090 and ends at position 1141; the E-value for the ATP_Ca_trans_C domain shown below is 3.4e-23.
GQILWVRGLNRIQTQIRVVKLFHNNHEVAHKPKNRSSIHTFMTQPEYPADDE
ATP_Ca_trans_C |
---|
PFAM accession number: | PF12424 |
---|---|
Interpro abstract (IPR022141): | This domain represents the C terminus of a calcium transporting ATPase located in the plasma membrane [ (PUBMED:19218514) ]. This domain is found in eukaryotes, and is approximately 60 amino acids in length. It contains a conserved QTQ sequence motif. |
GO function: | calcium transmembrane transporter activity, phosphorylative mechanism (GO:0005388) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_Ca_trans_C