The domain within your query sequence starts at position 1090 and ends at position 1151; the E-value for the ATP_Ca_trans_C domain shown below is 4.8e-26.

GQILWVRGLNRIQTQIRVVKLFHNNHEVAHKPKNRSSIHTFMTQPEYPADDELSQSFLDI
QE

ATP_Ca_trans_C

ATP_Ca_trans_C
PFAM accession number:PF12424
Interpro abstract (IPR022141):

This domain represents the C terminus of a calcium transporting ATPase located in the plasma membrane [(PUBMED:19218514)]. This domain is found in eukaryotes, and is approximately 60 amino acids in length. It contains a conserved QTQ sequence motif.

GO function:calcium-transporting ATPase activity (GO:0005388)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_Ca_trans_C