The domain within your query sequence starts at position 24 and ends at position 87; the E-value for the ATP_bind_1 domain shown below is 1.8e-26.

VLGMAGSGKTTFVQRLTGHLHNKGCPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQY
PFPH

ATP_bind_1

ATP_bind_1
PFAM accession number:PF03029
Interpro abstract (IPR004130):

Proteins in this entry belong to the GPN-loop GTPase family [(PUBMED:17468740)], including Npa3 (also known as Gpn1) and Gpn2/3 from budding yeasts. In humans, Npa3 homologue is known as XAB1; Gpn2 is known as GPN2/ATPBD1B; Gpn3 is known as Parcs.

Npa3 plays an important part in transporting RNA polymerase II (RNAPII) to the nucleus. The binding of Npa3 with RNAPII is GTP-dependent [(PUBMED:21844196)]. Gpn2 and Gpn3 are putative GTPase that have a role in biogenesis of RNA polymerase II and III [(PUBMED:23267056)]. Npa3, Gpn2 and Gpn3 is involved in sister chromatid cohesion [(PUBMED:21532343), (PUBMED:23324351)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_bind_1