The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the ATP_synth_reg domain shown below is 7.6e-33.

MAGAESDGQFQFTGIKKYFNSYTLTGRMNCVLATYGGIALLVLYFKLRPKK

ATP_synth_reg

• PFAM accession number: PF14960
• Interpro abstract (IPR009125):

  DAPIT is a subunit of mitochondrial ATP synthase that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain [ (PUBMED:26161955) (PUBMED:21345788) ]. In humans DAPIT (also known as ATP5MD) is a minor subunit of the mitochondrial membrane ATP synthase required for dimerization of the ATP synthase complex and as such regulates ATP synthesis in the mitochondria [ (PUBMED:21345788) (PUBMED:29917077) ].

  Mutations of the ATP5MD gene cause mitochondrial complex V deficiency, nuclear type 6 (MC5DN6), an autosomal recessive mitochondrial disorder characterized by gross motor developmental delay manifesting in the first years of life, and subsequent episodic developmental regression [ (PUBMED:29917077) ].

• GO component: mitochondrial proton-transporting ATP synthase complex (GO:0005753)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP_synth_reg