The domain within your query sequence starts at position 391 and ends at position 421; the E-value for the ATXN-1_C domain shown below is 8.7e-15.
GLHLGKPGHRSYALSPHTVIQTTHSASEPLP
ATXN-1_C |
![]() |
---|
PFAM accession number: | PF12547 |
---|---|
Interpro abstract (IPR020997): | This entry represents Capicua transcriptional repressor modulator Ataxin-1, which directly binds Capicua and modulates Capicua repressor activity in Drosophila and mammalian cells. It is also thought to be involved in RNA metabolism and the expansion of the polyglutamine tract may alter this function. Ataxin-1 is typically between 49 and 781 amino acids in length and have a conserved IQT sequence motif. The polyglutamine expanded mutant type of Ataxin-1 does not bind Capicua with as high affinity as wild-type Ataxin-1. It is associated with spinocerebellar ataxia type 1 (SCA1) [ (PUBMED:17190598) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATXN-1_C