The domain within your query sequence starts at position 163 and ends at position 229; the E-value for the AXE1 domain shown below is 3.7e-8.

EGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSI
PHMASTL

AXE1

AXE1
PFAM accession number:PF05448
Interpro abstract (IPR008391): This domain can be found in several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyse the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan [(PUBMED:10878123)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AXE1