The domain within your query sequence starts at position 6 and ends at position 50; the E-value for the AZUL domain shown below is 1.4e-17.
AKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKA
AZUL |
---|
PFAM accession number: | PF16558 |
---|---|
Interpro abstract (IPR032353): | The AZUL or amino-terminal zinc-binding domain of ubiquitin E3a ligase (Ube3A) is found in eukaryotes, and is an unusual zinc-finger domain. The final cysteine is usually mutated in Angelman syndrome patients. It is likely that AZUL plays a role in Ube3A substrate-recognition [ (PUBMED:21947926) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AZUL