The domain within your query sequence starts at position 393 and ends at position 825; the E-value for the AbLIM_anchor domain shown below is 1.9e-139.

TRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEP
FYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTP
TTSRSPQHFHRPELLSPGVHRWSPLRTSSFSSTHSDSRPNPPFRHHFLPHVKGNEPSSGR
NSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKASEDIIKFS
KFPAAQAPDPNEIPKIETDHWPGPPSLAAVGTDPRRRSSGREEDEEELLRRRQLQEEQLM
KLNSGLGQLILKEEMEKESRERASLASRYDSPLHSASHAPSSKTSSLPGYGKNGLHRPVS
TDFAQYNSYGDISGGVRDYQTLPDGHMPAVRMDRGVSMPNMLEPKIFPYEMLMVTNRGRN
KILRDVDRTRLER

AbLIM_anchor

AbLIM_anchor
PFAM accession number:PF16182
Interpro abstract (IPR032402):

This is a domain lying between the LIM actin-binding and the vilin-head domains of actin-binding LIM proteins (abLIMs). It is likely that this domain is involved in anchoring abLIMs to circumferential actin bundles in specific cell types [(PUBMED:20709423)]. It is also found in Dematin, an actin-binding protein originally identified in the junctional complex of the erythrocyte plasma membrane [(PUBMED:19241372)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AbLIM_anchor