The domain within your query sequence starts at position 1270 and ends at position 1384; the E-value for the AbfB domain shown below is 7.5e-10.

DLAPGDISSFLLTAALYKAKAHDPDVVSLEAADRPNFFLHTTANGSIGLAKWQRDEAFHQ
HASFSLHRGTWQAGLVALESLAKPGSFLHSSGLELALRAYEHTEVFRGGALFRLL

AbfB

AbfB
PFAM accession number:PF05270
Interpro abstract (IPR007934):

Alpha-L-arabinofuranosidase B (AkAbfB) comprises two domains: a catalytic domain and an arabinose-binding domain (ABD). This entry represents the ABD domain. ABD has a beta-trefoil fold similar to that of carbohydrate-binding module (CBM) family 13 but also with a number of distinctive characteristics, suggesting that it could be classified into a new CBM family [(PUBMED:15292273)].

GO process:L-arabinose metabolic process (GO:0046373)
GO function:alpha-L-arabinofuranosidase activity (GO:0046556)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AbfB