The domain within your query sequence starts at position 37 and ends at position 99; the E-value for the Abhydro_lipase domain shown below is 2.8e-21.

VSQIIKHWEYPSEEYEVVTDDGYILPINRIPHGKNNANSSAPKMVVFCLPGLFSTAGVWV
SNP

Abhydro_lipase

Abhydro_lipase
PFAM accession number:PF04083
Interpro abstract (IPR006693):

The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is similar: an alpha/beta sheet, not barrel, of eight beta-sheets connected by alpha-helices [(PUBMED:1409539)]. This entry represents the N-terminal part of an alpha/beta hydrolase domain found in a number of lipases.

GO process:lipid metabolic process (GO:0006629)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abhydro_lipase