The domain within your query sequence starts at position 11 and ends at position 228; the E-value for the Abhydrolase_2 domain shown below is 4.8e-89.

LTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY
TALTCPHPLAGIVALSCWLPLHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEK
LRTVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLL

Abhydrolase_2

Abhydrolase_2
PFAM accession number:PF02230
Interpro abstract (IPR003140): This entry represents the alpha/beta hydrolase domain found in phospholipases [(PUBMED:9644627)], carboxylesterases [(PUBMED:9438866)] and thioesterases.
GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abhydrolase_2