The domain within your query sequence starts at position 73 and ends at position 227; the E-value for the Abhydrolase_5 domain shown below is 8.1e-21.

EVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPGFGNSAPSEEVSTEAGRVELLER
VFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQLRGFVPIAPTSTRNYAQEQFGAVKTPTL
ILYGELDHTLARESLQQLRHLPNHSVVKLHDAGHA

Abhydrolase_5

Abhydrolase_5
PFAM accession number:PF12695
Interpro abstract (IPR029059):

The alpha/beta hydrolase fold [(PUBMED:1409539)] is common to a number of hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is an alpha/beta-sheet (rather than a barrel), containing 8 strands connected by helices [(PUBMED:1409539)]. The enzymes are believed to have diverged from a common ancestor, preserving the arrangement of the catalytic residues. All have a catalytic triad, the elements of which are borne on loops, which are the best conserved structural features of the fold. Esterase (EST) from Pseudomonas putida is a member of the alpha/beta hydrolase fold superfamily of enzymes [(PUBMED:16321951)].

In most of the family members the beta-strands are parallels, but some have an inversion of the first strands, which gives it an antiparallel orientation. The catalytic triad residues are presented on loops. One of these is the nucleophile elbow and is the most conserved feature of the fold. Some other members lack one or all of the catalytic residues. Some members are therefore inactive but others are involved in surface recognition. The ESTHER database [(PUBMED:14681380)] gathers and annotates all the published information related to gene and protein sequences of this superfamily [(PUBMED:14681380)].

This entry matches a diverse range of alpha/beta hydrolase enzymes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abhydrolase_5