The domain within your query sequence starts at position 93 and ends at position 170; the E-value for the Abi_HHR domain shown below is 5.1e-39.

ISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHG
VKWLKAKHGNNQPARTGT

Abi_HHR

Abi_HHR
PFAM accession number:PF07815
Interpro abstract (IPR012849):

The region is found towards the N terminus of a number of adaptor proteins that interact with Abl-family tyrosine kinases [(PUBMED:12011975)]. More specifically, it is termed the homeo-domain homologous region (HHR), as it is similar to the DNA-binding region of homeo-domain proteins [(PUBMED:7590236)]. Other homeo-domain proteins have been implicated in specifying positional information during embryonic development, and in the regulation of the expression of cell-type specific genes [(PUBMED:7590236)]. The Abl-interactor proteins are thought to coordinate the cytoplasmic and nuclear functions of the Abl-family kinases, and seem to be involved in cytoskeletal reorganisation, but their precise role remains unclear [(PUBMED:12011975)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Abi_HHR