The domain within your query sequence starts at position 374 and ends at position 547; the E-value for the Acatn domain shown below is 3.7e-35.

LNIFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPLYYYIIVLLSYALHQVTLYSMYVSI
MAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQNCRTPDA
IELCKKLGGSCVTALDGYYVESIICVLIGFGWWFFLGPKFKKLQDEGPSSWKCK

Acatn

Acatn
PFAM accession number:PF13000
Interpro abstract (IPR024371):

Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [(PUBMED:10570973), (PUBMED:9096318)].

This entry represents acatn and its homologues.

GO component:integral component of membrane (GO:0016021)
GO function:acetyl-CoA transmembrane transporter activity (GO:0008521)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acatn