The domain within your query sequence starts at position 3 and ends at position 160; the E-value for the Acid_PPase domain shown below is 3e-62.
RLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQNIQLYPEVPEVLGRLQSLG VPVAAASRTSEIQGANQLLELFDLGKYFIQREIYPGSKVTHFERLHHKTGVPFSQMVFFD DENRNIIDVGRLGVTCIHIRDGMSLQTLTQGLETFAKA
Acid_PPase |
---|
PFAM accession number: | PF12689 |
---|---|
Interpro abstract (IPR010036): | This entry represents two closely related clades of sequences from eukaryotes and archaea. The mouse enzyme has been characterised as a phosphatase and has been positively identified as a member of the haloacid dehalogenase (HAD) superfamily by site-directed mutagenesis of the active site residues [ (PUBMED:11601995) (PUBMED:10889041) ]. |
GO function: | phosphatase activity (GO:0016791) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acid_PPase