The domain within your query sequence starts at position 26 and ends at position 100; the E-value for the Activin_recp domain shown below is 4.9e-15.

LKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTE
CCFTDFCNNITLHLP

Activin_recp

Activin_recp
PFAM accession number:PF01064
Interpro abstract (IPR000472):

This is a hydrophilic cysteine-rich ligand-binding domain found in both TGF-beta receptor types (type I and II). In both types, this domain posses a 9 amino acid cysteine box, with the the consensus CCX{4-5}CN. The type I receptors also possess 7 extracellular residues preceding the cysteine box [(PUBMED:9309176), (PUBMED:8299934), (PUBMED:8397373)].

The Transforming growth factor-beta superfamily of ligands include: bone morphogenetic proteins (BMPs), growth and differentiation factors (GDFs), anti-mullerian hormone (AMH), activin, nodal and TGF-beta. Signalling begins with the binding of a TGF-beta superfamily ligand to a TGF-beta type II receptors. The type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators [(PUBMED:9759503)].

The receptors for most of the members of this growth factor family are related. They are receptor-type kinases of Ser/Thr type, which have a single transmembrane domain and a specific hydrophilic Cys-rich ligand-binding domain [(PUBMED:9023056), (PUBMED:8047140), (PUBMED:8909794)].

GO component:membrane (GO:0016020)
GO function:transmembrane receptor protein serine/threonine kinase activity (GO:0004675)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Activin_recp