The domain within your query sequence starts at position 32 and ends at position 108; the E-value for the Acyl-ACP_TE domain shown below is 6.8e-8.

LLPRNAARSVSTSSANQRAEDPHRQLEAYGYFLPIQTRWQDNDQNSHVNNAVYYSYFDTV
ISHYLIRYCGLKTSLLT

Acyl-ACP_TE

Acyl-ACP_TE
PFAM accession number:PF01643
Interpro abstract (IPR002864):

This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [ (PUBMED:7479856) ]. These proteins contain a duplication of two 4HBT-like domains.

GO process:fatty acid biosynthetic process (GO:0006633)
GO function:thiolester hydrolase activity (GO:0016790)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl-ACP_TE