The domain within your query sequence starts at position 15 and ends at position 133; the E-value for the Acyl-CoA_ox_N domain shown below is 4.4e-39.

NPELITHILDGSPENTRRRREIENLILNDPDFQHEDYNFLTRSQRYEVAVKKSATMVKKM
REFGIADPEEIMWFKNSVHRGHPEPLDLHLGMFLPTLLHQATEEQQERFFMPAWNLEIT

Acyl-CoA_ox_N

Acyl-CoA_ox_N
PFAM accession number:PF14749
Interpro abstract (IPR029320):

Acyl-coenzyme A oxidase consists of three domains. An N-terminal alpha-helical domain, a beta sheet domain IPR006091 and a C-terminal catalytic domain IPR002655. This entry represents the N-terminal alpha-helical domain [(PUBMED:15581893)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl-CoA_ox_N