The domain within your query sequence starts at position 32 and ends at position 148; the E-value for the Acyl-CoA_ox_N domain shown below is 6.3e-29.
SVERLTNILDGGIPNTELRRRVESLIQRDPVFNLKHLYFMTRDELYEDAVQKRFHLEKLA WSLGWSEDGPERIYADRVLAGYNNLNLHGIAMNAIRSLGSDEQIAKWGQLGKNFQII
Acyl-CoA_ox_N |
---|
PFAM accession number: | PF14749 |
---|---|
Interpro abstract (IPR029320): | Acyl-coenzyme A oxidase consists of three domains. An N-terminal alpha-helical domain, a beta sheet domain IPR006091 and a C-terminal catalytic domain IPR002655 . This entry represents the N-terminal alpha-helical domain [ (PUBMED:15581893) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl-CoA_ox_N