The domain within your query sequence starts at position 493 and ends at position 810; the E-value for the Acyl_transf_1 domain shown below is 9.5e-115.

WFICSGMGTQWRGMGLSLMRLDSFRESILRSDEAVKPLGVKVSDLLLSTDERTFDDIVHA
FVSLTAIQIALIDLLTSVGLKPDGIIGHSLGEVACGYADGCLSQREAVLAAYWRGQCIKD
AHLPPGSMAAVGLSWEECKQRCPAGVVPACHNSEDTVTISGPQAAVNEFVEQLKQEGVFA
KEVRTGGLAFHSYFMEGIAPTLLQALKKVIREPRPRSARWLSTSIPEAQWQSSLARTSSA
EYNVNNLVSPVLFQEALWHIPEHAVVLEIAPHALLQAVLKRGVKSSCTIIPLMKRDHKDN
LEFFLTNLGKVHLTGINV

Acyl_transf_1

Acyl_transf_1
PFAM accession number:PF00698
Interpro abstract (IPR014043):

Enzymes like bacterial malonyl CoA-acly carrier protein transacylase (EC 2.3.1.39) and eukaryotic fatty acid synthase (EC 2.3.1.85) that are involved in fatty acid biosynthesis belong to this group. Also included are the polyketide synthases 6-methylsalicylic acid synthase (EC 2.3.1), a multifunctional enzyme that involved in the biosynthesis of patulin and conidial green pigment synthase (EC 2.3.1).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyl_transf_1