The domain within your query sequence starts at position 241 and ends at position 314; the E-value for the Acyltransf_C domain shown below is 2.1e-29.

LGILYGKKYEADMCVRRFPLEDIPADETSAAQWLHKLYQEKDALQEMYKQKGVFPGEQFK
PARRPWTLLNFLCW

Acyltransf_C

• PFAM accession number: PF16076
• Interpro abstract (IPR032098):

  This domain is found at the C terminus of several lysophospholipid acyltransferases, including 1-acyl-sn-glycerol-3-phosphate acyltransferase (also known as lysophosphatidic acid acyltransferase), acyl-CoA:lysophosphatidylglycerol acyltransferase 1, and lysocardiolipin acyltransferase 1, which has both lysophosphatidylinositol and lysophosphatidylglycerol acyltransferase activities [ (PUBMED:19075029) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyltransf_C