The domain within your query sequence starts at position 310 and ends at position 384; the E-value for the Acyltransf_C domain shown below is 1.5e-18.
ILGYRKPTVTHVHYRIFPIGDVPLETEDLTSWLYQRFIEKEDLLSHFYKTGAFPPPQGQK EAVCREMTLSNMWIF
Acyltransf_C |
---|
PFAM accession number: | PF16076 |
---|---|
Interpro abstract (IPR032098): | This domain is found at the C terminus of several lysophospholipid acyltransferases, including 1-acyl-sn-glycerol-3-phosphate acyltransferase (also known as lysophosphatidic acid acyltransferase), acyl-CoA:lysophosphatidylglycerol acyltransferase 1, and lysocardiolipin acyltransferase 1, which has both lysophosphatidylinositol and lysophosphatidylglycerol acyltransferase activities [ (PUBMED:19075029) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyltransf_C