The domain within your query sequence starts at position 92 and ends at position 129; the E-value for the Acyltransferase domain shown below is 1.8e-7.

RFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKR

Acyltransferase

Acyltransferase
PFAM accession number:PF01553
Interpro abstract (IPR002123):

This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function [ (PUBMED:9259571) ]. This domain is found in tafazzins, defects in which are the cause of Barth syndrome; a severe inherited disorder which is often fatal in childhood and is characterised by cardiac and skeletal abnormalities. Phospholipid/glycerol acyltransferase is not found in the viruses or the archaea and is under represented in the bacteria. Bacterial glycerol-phosphate acyltransferases are involved in membrane biogenesis since they use fatty acid chains to form the first membrane phospholipids [ (PUBMED:18369234) ].

GO function:transferase activity, transferring acyl groups (GO:0016746)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Acyltransferase