The domain within your query sequence starts at position 110 and ends at position 220; the E-value for the Adhes-Ig_like domain shown below is 2.4e-57.

AFPDQLVVSPEFLVPGQDQVVSCTAHNIWPADPNSLSFALLLGEQRLEGAQALEPEQEEE
IQEAEGTPLFRMTQRWRLPSLGTPAPPALHCQVTMQLPKLVLTHRKEIPVL

Adhes-Ig_like

Adhes-Ig_like
PFAM accession number:PF09085
Interpro abstract (IPR015169):

This domain is found in mucosal vascular addressin cell adhesion molecule 1 proteins (MAdCAM-1). These are cell adhesion molecules expressed on the endothelium in mucosa that guide the specific homing of lymphocytes into mucosal tissues. MAdCAM-1 belongs to a subclass of the immunoglobulin superfamily (IgSF), the members of which are ligands for integrins [(PUBMED:9655832)]. The crystal structure of this domain has been reported; it adopts an immunoglobulin-like beta-sandwich structure, with seven strands arranged in two beta-sheets in a Greek-key topology [(PUBMED:11807247), (PUBMED:9655832)].

GO process:cell adhesion (GO:0007155)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Adhes-Ig_like