The domain within your query sequence starts at position 1 and ends at position 79; the E-value for the Adipogenin domain shown below is 5.8e-47.
MKYPLVPLVSDLTLSFLVFWLCLPVALLLFLTIVWLHFLLSQESKEDDSDLCFNWEPWSK RPSECGCEETFPGEEDGLH
Adipogenin |
 |
|---|
| PFAM accession number: | PF15202 |
|---|---|
| Interpro abstract (IPR027938): | This family of proteins is involved in the stimulation of adipocyte differentiation and development [ (PUBMED:16132694) ]. |
| GO process: | fat cell differentiation (GO:0045444) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Adipogenin